Nina Spelling 04/29/24
Cheryl Shipp
Monday
Apr 29, 2024
COINCIDENT abnegationautonomouscarcinogencentrifugalcommencementcomprehensioncontemporaneousconvalescentcorrespondencedividendforbearanceimperturbablelaboriouslegislationneurologicalneurosisopaqueornithologyparaphrasablepreponderancerapacioussacrilegiousteleologicalturducken
Load
Accommodated List 2nd Gr 15 #1-10
Monday
Apr 29, 2024
beanbeatleanmeanpleasereachreadrealteachteam
Load
5/6B List 15 #11-End Practice
Monday
Apr 29, 2024
Illinoisactuallycauliflowerdonkeysearliestembargoesghostreindeersovietstreet
Load
6th A List 15 #11-End Practice
Monday
Apr 29, 2024
belieffictitiousfollowedformsgovernmentpostponepressurescenariosingleunderstanding
Load
7th A/B List 15 #11-End Practice
Monday
Apr 29, 2024
accompliceadversecafeteriadeodorantexecutiveintrospectivemotoristmusicianoccasionquestionnairetechnically
Load
Roman Spelling Words WK 30
Monday
Apr 29, 2024
blisterbreathcomiccrushdirectfeatherfranticgraspgravityhymnnumbpromiseshovelswiftwobble
Load
Long U Spelling Practice
Monday
Apr 29, 2024
beganbruisecruisegloomholdigloojuicejuicymarketproofscoopscootershooksuittogether
Load
Monday
Apr 29, 2024
aboutflowersgroundgrowlingmouthplowpowershowersouthsprout
Load
List 26
Kirsten Schwalbach
Sunday
Apr 28, 2024
ArkansasLouisianadescribabledescribedescriptionentrustrespondresponseresponsivesuggestsuggestionsuggestivesweetsweetensweetnesstrusteetrustworthyweighweightweighty
Load
Stephanee Green
Sunday
Apr 28, 2024
beginbeginnerbeginnerbeginningcontrolcontrolledcontrollingdragdraggingplanplannedplannerplanningsubmitsubmittedtrottrottedtrotting
Load
Unit 4 week 4 Homophones
Sunday
Apr 28, 2024
beatbeetboughtitsit’speacepieceroadroderowedsailsalesceneseentalkedtaughttheirthey’reyouryou’re
Load
Spelling List # 19
Sunday
Apr 28, 2024
apartment armartcarcarpetdarkfarmhardjarparkpartpartysparkstarstartyard
Load
Unit 5 - Week 6: Spelling Test
Sunday
Apr 28, 2024
analogareacentimeterclockcongruentdigitalelapsedinchlengthliquidmeasurementmeterperimeterpolygonprobabilityquadrilateralquartssymmetrytemperaturevolume
Load
GRADE 6 Week 35
Sunday
Apr 28, 2024
attitudebehemothberserkboycottbrochurebungalowcoyotefiestagondolahibachijubileestrudeltrophytsunamityphoon
Load
4.3.3 week 2
Walter Mcgee
Sunday
Apr 28, 2024
arrangebadgebridgegeneralgermsgingerglanceorangespongestrangevillagewedge
Load
4.3.3 week 1
Walter Mcgee
Sunday
Apr 28, 2024
cementcenterceremonycertainchancecircusonceouncepolicescenespice
Load
Marsha Elliott
Sunday
Apr 28, 2024
Commission charity collideillustratelegible mythovservant partialthrifty vivid
Load
sped 4 reading 641752-1085370-j9w5
lilliyth
Sunday
Apr 28, 2024
crydanny and samantha fenton find's out dj and lilith snuck soph. and kenna. into ghost zone. twin's not in trouble. but dj. and lilith are in big troubledanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny fenton give's a serious sharp slap to dj. and lilith's shoulder's. for putting the twin's in danger of the ghost zonedanny fenton is so mad. and disappointed in dj. and lilith. for putting mckenna. and sophia into somuch danger. of such forcing them into gjost zonedj. and lilith fenton forcefully involve's theire twin baby sister's: mckenna. and sophia. into ghost zonedj. and lilith fenton forcefully involve's theire twin baby sister's: mckenna. and sophia. into ghost zone. mommy and daddy find's this out. theire severly angry at dj and lilith. but. are worried about the twin's.danny doe's an emergency check up on the girl's. he goe's ghost. and check's for anything serious on the girl'soww
Load
Spelling Lesson 21 R Controlled vowels -ar
Sunday
Apr 28, 2024
apartmentarborarmorartistcargocarnivalcarpetcartongarbagegardengarlandgarmentharborharnessharvestmarketpardonparlorscarlettarget
Load
Marsha Elliott
Sunday
Apr 28, 2024
radiantVirginia (VA)colonelcuriousdeceptiondespisedeterminedisappointdisasterevangelistmaterialsupposed
Load
sped 4 reading 641749-1085359-nm4j
lilliyth
Sunday
Apr 28, 2024
breakdown'scrydanny and samantha fenton find's out dj and lilith snuck soph. and kenna. into ghost zone. twin's not in trouble. but dj. and lilith are in big troubledanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny fentondanny fenton-phantomdanny phantomdj. and lilith fenton forcefully involve's theire twin baby sister's: mckenna. and sophia. into ghost zonedj. and lilith fenton forcefully involve's theire twin baby sister's: mckenna. and sophia. into ghost zone. mommy and daddy find's this out. theire severly angry at dj and lilith. but. are worried about the twin's.danny doe's an emergency check up on the girl's. he goe's ghost. and check's for anything serious on the girl'smckenna and sophia fentonmckenna and sophia fenton has emotional breakdown'smckenna and sophia fenton has mental breakdown'smckenna and sophia fenton has physical breakdown'smckenna and sophia fenton has psychological breakdown'sptsdptsd cause's mckenna and sophia fenton. into vvarious breakdown's
Load
Unit 4 Lesson 2
Tiffany Harbison
Sunday
Apr 28, 2024
activitybreathlesscarelesselectricityendlessfixableharmfulhelpfullikablenotablepainfulpennilessplentifulraritysanitysleeplesswearablewishful
Load
Stacey Sugg
Sunday
Apr 28, 2024
don'tjoinedkickedliftedlookedpaintedplayedprayedsighedsnowedsoundedthankedtherewantedwashed
Load
Spelling List 23
Stacey Sugg
Sunday
Apr 28, 2024
don'tjoinedkickedliftedlookedpaintedplayedprayedsighedsnowedsoundedthankedtherewantedwashed
Load
Spelling List 22
Stacey Sugg
Sunday
Apr 28, 2024
don'tjoinedkickedliftedlookedpaintedplayedprayedsighedsnowedsoundedthankedtherewantedwashed
Load
Lesson 20 Spelling worksheet
Daviette Powell
Sunday
Apr 28, 2024
alligatorbandanaburritocaravancargocathedraldungareesgallanthammockiguanalassomattressmosquitopajamaspatioplazaponchosalsasiestasombrerotambourinetomatotsunamitycoonvanilla
Load
3.4.5 week 2
Walter Mcgee
Sunday
Apr 28, 2024
cagechangesgiantgymsmassagesmessagesnicepagespeacefulracerange
Load
3.4.5 week 1
Walter Mcgee
Sunday
Apr 28, 2024
agecentsdicegiraffemiceofficeplacedpouncepricespacewage
Load
unit 101
Melinda Dubois
Sunday
Apr 28, 2024
boldlybravelycalmlyfirmlygladlyhardlyinstantlylightlylovelysadlysafelysilentlyswiftlywidelywrongly
Load
A Wrinkle in Time Week 1 Vocab
Sunday
Apr 28, 2024
IQ bunsen burner constable delinquent diction dignity frivol intention liniment liverwurst moderation preliminary privilege prodigious relinquished scornfully scud squelch supine supineagility
Load
1.4.5 week 2
Walter Mcgee
Sunday
Apr 28, 2024
bunnycandychillyhoneylumpymoneymonkeypretty
Load
Sunday
Apr 28, 2024
Argue CocoaCone Disagree DisobeysDistrust FuelHumid PureSoapTowUnable Unlock Unplanned Unzipped
Load
sped 4 reading 641737-1085276-n2vj
Sunday
Apr 28, 2024
emomckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turnedmckenna and sophia fenton psychopathic ghost-human twin'smckenna and sophia fenton psychopathic-emo ghost-human twin'smckenna and sophia fenton psychopathic-goth ghost-human twin'smckenna and sophia fenton-phantom psychopathic ghost-human twin'smckenna and sophia fenton-phantom psychopathic-emo ghost-human twin'smckenna and sophia fenton-phantom psychopathic-goth ghost-human twin'smckenna and sophia phantom psychopathic ghost-human twin'smckenna and sophia phantom psychopathic-emo ghost-human twin'smckenna and sophia phantom psychopathic-goth ghost-human twin'sprotagonistprotagonisticprotagonistic emogothic psychological ptsd psychgirl's love's mommy and daddyprotagonistic emogothic psychological ptsd psychogirl's love's mommy and daddyprotagonistic emogothic psychological ptsd psychomute girl's love's mommy and daddyprotagonistic emogothic psychological ptsd psychomute hero girl's love's mommy and daddyprotagonistic emogothic psychological ptsd psychomute psycopath hero girl's love's mommy and daddyprotagonistic emogothic psychological ptsd psychomute psycopathic hero girl's love's mommy and daddypsychopathpsychopathicpsychopathic-emopsychopathic-emogothpsychopathic-emogothicpsychopathic-gothpsychopathic-gothicsuprizingly. danny and samantha fenton-phantom like's mckenna and sophia's protagonistic emogothic psychological ptsd psychomute psycopathic hero girl's charactersuprizingly. danny and samantha fenton-phantom like's mckenna and sophia's protagonistic emogothic psychological ptsd psychomute psycopathic hero girl's personalitysuprizingly. mommy and daddy like's mckenna and sophia fenton-phantom's protagonistic emogothic psychological ptsd psychomute psycopathic hero girl's charactersuprizingly. mommy and daddy like's mckenna and sophia fenton-phantom's protagonistic emogothic psychological ptsd psychomute psycopathic hero girl's personality
Load
1.4.5 week 1
Walter Mcgee
Sunday
Apr 28, 2024
bumpyfunnykeynearpennypuppysandywould
Load
BM List #3 Literacy 5
Sunday
Apr 28, 2024
adventurouscautiousenormousfabuloushumorousjealousnumerousobiousridiculoussuspicious
Load
sped 4/5 reading 641734-1085268-3cm2
lillie
Sunday
Apr 28, 2024
emoemo punkemo-psychemo-psychogothemo-psychogoth punkemogothemopsychemopsychogothic punkgothic punk psychgothic punk psychomckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghostmckenna and sophia fenton-phantom has ptsdmckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddymckenna and sophia phantom has ptsdpsychpsychgothpsychopsycho twin'spsycho-emopunk-gothpycho punk
Load
sped 4/5 ela 641733-1085262-9qnc
Sunday
Apr 28, 2024
a set of phantom twin's. McKenna and Sophia Fenton are half ghost-half human kid's. theire mom was very ill when she gave birth to them. they have a rare illness named: classic galactosemia. theire parent's, Danny and Samantha Fenton, take good care of them. they need to become full ghost's by the age of 14. or they will lose theire ghost power's forever. if this happen's, they will die and become fully inactive ghost'sa set of phantom twin's. McKenna and Sophia Fenton. are half ghost-half human kid's. theire mom was very ill when she gave birth to them. they have a rare illness since birth. named: classic galactosemia. theire parent's, Danny and Samantha Fenton, take good care of them. they need to become full ghost's by the age of 14. or they will lose theire ghost power's forever. if this happen's, they will die and become fully inactive ghost'sdanny and samantha fenton sedating theire youngest children- twin daughter's: mckenna. and sophia. to try to calm them downdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghostmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turnedmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turned. then theire ghost-human status will be full ghost like theire family already ismckenna and sophia fenton has ptsdmckenna and sophia fenton has unknowingly underestimated unintentionally violently wild-aggressive ptsdmckenna and sophia fenton has unknowingly underestimating unintentionally violently wild-aggressive ptsdmckenna and sophia fenton has unknowingly. and unintentionally violently wild-aggressive ptsdmckenna and sophia fenton has unknowingly. and unintentionally violently wild-aggressive ptsd. danny or samantha don't punish. or don't diciplin them for thismckenna and sophia fenton has unknowingly. and unintentionally violently wild-aggressive ptsd. mommy or daddy don't punish. or don't diciplin them for thismckenna and sophia fenton-phantom has ptsdmckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddymckenna and sophia phantom has ptsdptsdwarm hug and firm-soft tender kisse's to head and facewarm loving hug's and kisses
Load
Unit 5 Week 5 Wonders
Chelsea Pettis
Sunday
Apr 28, 2024
concentrationconcetrateconfuseconfusioncorrectcorrectiondecoratedecorationdiscussdiscussionelectelectionestimateestimationexhaustexhaustionimpressimpressionlocatelocation
Load
Angela Griffith
Sunday
Apr 28, 2024
airbarebearbeardcarechairearhairnearpairpearshare stairswear
Load
term two week 3
Brad Turner
Sunday
Apr 28, 2024
Wednesdayanythingaveragebeautifulbureaucalculatorcameracustomereverywherefamilieslibrariesminorovertreactseasonseizuresilencesomebodyvitalvocal
Load
sped 4 reading 641729-1085255-x4tr
elizabeth
Sunday
Apr 28, 2024
classic galactosemiaclassic galactosemia and carrier of itdanny fenton has severe ptsd. and is a carrier of itdanny phantom has severe ptsd. and carrie's itdanny phantom has severe ptsd. and is a carrier of itfully-inactive permanent phantom ghostgalactosemiagalactosemia and carrier of itmckenna and sophia fenton was born with severe type1 classic galactosemiamckenna and sophia fenton was born with severe type1 classic galactosemia. and are carrier's of itmckenna and sophia fenton was born with severe type1 classic galactosemia. and carry itsophia and mckenna fenton
Load
Unit 5 Week 4 Wonders
Chelsea Pettis
Sunday
Apr 28, 2024
bottomlessceaselessdarknesseffortlessemptinessfearlessfiercenessfondnessfoolishnessforgivenessfullnessgladnessharmlesshopelessmeaninglessmotionlessneedlesssadnessstillnessweakness
Load
Unit 4 Week 3
Sunday
Apr 28, 2024
consecutivefadehobbyincentiveneglect
Load
sped 4/5 reading 641726
elizabeth
Sunday
Apr 28, 2024
crydanny fenton teaching mckenna and sophia self defencedanny fenton-phantom teaching mckenna and sophia self defencedanny phantom teaching mckenna and sophia self defencefully-inactive permanent phantommckenna and sophia fenton will need to be turned into ghost. no lster then age 14. or they'd die. and become inactive for goodmckenna and sophia fenton will need to be turned into ghost. no lster then age 14. or they'd die. and become inactive for lifemckenna and sophia fenton will need to be turned into ghost. no lster then age 14. or they'd die. and become indefinitely inactivemckenna and sophia fenton will need to be turned into ghost. no lster then age 14. or they'd die. and become permanently inactivemckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddy
Load
sped 4/5 reading 641725-1085244-5hzc
elizabeth
Sunday
Apr 28, 2024
crydanny and samantha fenton sedating theire youngest children- twin daughter's: mckenna. and sophia. to try to calm them downdanny fentondanny fenton-phantomdanny phantomfully-inactive permanent phantommckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghostmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turnedmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turned. then theire ghost-human status will be full ghost like theire family already ismckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom'smckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddyptsd
Load
Susan Valetta
Sunday
Apr 28, 2024
beautifulcomfortabledependablefaithfulfearfulgracefullovablepredictablethoughtlessworthless
Load
sped 4/5 ela 641723-1085241-1jcv
Sunday
Apr 28, 2024
homehousemobile homervrv hometornadotrailer-hometwister
Load
sped 4 reading 641722-1085240-hdyb
lillie
Sunday
Apr 28, 2024
a set of phantom twin's. McKenna and Sophia Fenton are half ghost-half human kid's. theire mom was very ill when she gave birth to them. they have a rare illness named: classic galactosemia. theire parent's, Danny and Samantha Fenton, take good care of them. they need to become full ghost's by the age of 14. or they will lose theire ghost power's forever. if this happen's, they will die and become fully inactive ghost'sa set of phantom twin's. McKenna and Sophia Fenton. are half ghost-half human kid's. theire mom was very ill when she gave birth to them. they have a rare illness since birth. named: classic galactosemia. theire parent's, Danny and Samantha Fenton, take good care of them. they need to become full ghost's by the age of 14. or they will lose theire ghost power's forever. if this happen's, they will die and become fully inactive ghost'sclassic galactosemiaclassic galactosemia and carrier of itcrydanny and samantha fenton sedating theire youngest children- twin daughter's: mckenna. and sophia. to try to calm them downdanny and samantha fenton sedating theire youngest children- twin daughter's: mckenna. and sophia. to try to calm them downdanny fenton has severe ptsd. and carrie's itdanny fenton has severe ptsd. and is a carrier of itdanny fenton-phantom has severe ptsd. and carrie's itdanny fenton-phantom has severe ptsd. and is a carrier of itdanny phantom has severe ptsd. and carrie's itdanny phantom has severe ptsd. and is a carrier of itfully-inactive permanent phantomfully-inactive permanent phantom ghostgalactosemiagalactosemia and carrier of itmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghostmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghostmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turnedmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turnedmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turned. then theire ghost-human status will be full ghost like theire family already ismckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turned. then theire ghost-human status will be full ghost like theire family already ismckenna and sophia fenton has ptsdmckenna and sophia fenton was born with severe galactosemiamckenna and sophia fenton was born with severe galactosemial and are carrier's of itmckenna and sophia fenton was born with severe galactosemial and carry itmckenna and sophia fenton was born with severe ptsdmckenna and sophia fenton was born with severe ptsd. and are carrier's of itmckenna and sophia fenton was born with severe ptsd. and carrie's itmckenna and sophia fenton was born with severe type1 classic galactosemiamckenna and sophia fenton was born with severe type1 classic galactosemia. and are carrier's of itmckenna and sophia fenton was born with severe type1 classic galactosemia. and carry itmckenna and sophia fenton-phantom has ptsdmckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom'smckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddymckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddymckenna and sophia phantom has ptsdptsdsamantha fenton has ptsd and carrie's itsamantha fenton has ptsd and is a carrier of itsamantha fenton-phantom has ptsd and carrie's itsamantha phantom has ptsd and carrie's itsamantha phantom has ptsd and is a carrier of itsped grade4 reading comprhension. online distence-inclement weather day. from 8:30am/to 3:30pm learning day. test one hour| 8:30am/9:45am test two hour| 9:53am/12:53pm. lunch/recess| 12:53pm/1:30pm. test three hour| 1:45pm/2:10pm final hour| 2:40pm/3:30pm
Load
sped 4 reading
Sunday
Apr 28, 2024
crydanny fenton holding onto mckenna and sphia during theire fear of tornado'sdanny fenton sedating mckenna and sophia to calm downdanny fenton-phantom holding onto mckenna and sphia during theire fear of tornado'sdanny fenton-phantom sedating mckenna and sophia to calm downdanny phantom holding onto mckenna and sphia during theire fear of tornado'sdanny phantom sedating mckenna and sophia to calm downfully-inactivefully-inactive permanent ghostfully-inactive permanent phantomfully-inactive permanent phantom ghostgenetic-metabolic disabilitygenetic-metabolic diseasegenetic-metabolic disorderjennifer fenton don't like spinachmckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them down. mommy and daddy. including the whole family are really scared seeing them having convulsion'smckenna and sophia fenton-phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia fenton-phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia fenton-phantom was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilitymckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddymckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them down. mommy and daddy. including the whole family are really scared seeing them having convulsion'smckenna and sophia phantom was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilitytulsa, oklahoma
Load
Wonders 2.1.1c
Trea Mac
Sunday
Apr 28, 2024
commondifferencesincludelightnearrowstilts
Load
Wonders 2.1.1c
Trea Mac
Sunday
Apr 28, 2024
commondifferencesincludelightnearrowstilts
Load
sped 4 reading 641718
lillie
Sunday
Apr 28, 2024
clingingdanny and samantha fenton are curious on how is classic galactosemia a disability. but they do believe it is a disability. theire just confused. and curiousmckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them down. mommy and daddy. including the whole family are really scared seeing them having convulsion'smckenna and sophia fenton has ptsdmckenna and sophia fenton was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilitymckenna and sophia fenton-phantom taking nap. but are fighting themselve's in fearmckenna and sophia fenton-phantom taking nap. but are fighting themselve's with fearptsd
Load
sped 4/5 reading 641717-1085210-mknx
lillie
Sunday
Apr 28, 2024
confusedcrycuriositycuriouscurious about classic galactosemiacurious about galactosemiadanny and samantha fenton are curious on how is classic galactosemia a disability. but they do believe it is a disability. theire just confused. and curiousdanny fenton testing his and samantha's daughter's: mckenna. and sophia. for dyslexia. they do have it. and are carrier's of itdanny fenton-phantom testing his and samantha's daughter's: mckenna. and sophia. for dyslexia. they do have it. and are carrier's of itdanny phantom testing his and samantha's daughter's: mckenna. and sophia. for dyslexia. they do have it. and are carrier's of itdyslexiahyperventilating in fearhyperventilating with fearmckenna and sophia fenton getting tested by daddy for dyslexia. they have itmckenna and sophia fenton was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilityshy
Load
Sunday
Apr 28, 2024
Britaindolphinferretfinishgentlegingergraphjollyjunglekneelmarginnightnoisephotorippletrafficwesternwhistlewindowwrinkle
Load
sped 4 read 641715-1085196-vp44
lillie
Sunday
Apr 28, 2024
crydanny and samantha fenton are curious on how is classic galactosemia a disability. but they do believe it is a disability. theire just confused. and curiousdanny fenton sedating mckenna and sophia to calm downdanny fenton-phantom sedating mckenna and sophia to calm downdanny phantom sedating mckenna and sophia to calm downinfant newborn twin babie's: mckenna and sophia fenton-phantom are born with severe type1 classic galactosemia. and are classic galactosemia carrier's. they were born without any enzyme's to dygest anything milk or dairy. this rare disease had doctor's forcing danny and samantha fenton-phantom to do a carrier testing. wich result's.they are classic galactosemia carrier's. and have the disease.with on top of this they were born without any enzyme's to dygest anything milk or dairy. just like theire infant newborn twin babie's has the rare genetic-metabolic disorder. this is a big worry to mommy and daddy. this disease causes worry. and ptsd to the whole familymckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them down. mommy and daddy. including the whole family are really scared seeing them having convulsion'smckenna and sophia fenton was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilitymckenna and sophia fenton-phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia fenton-phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia fenton-phantom was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilitymckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them down. mommy and daddy. including the whole family are really scared seeing them having convulsion'smckenna and sophia phantom was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilityptsd
Load
sped 4/6 read 641714-1085186-hw57
lillie
Sunday
Apr 28, 2024
crycryingdanny and samantha fenton are curious on how is classic galactosemia a disability. but they do believe it is a disability. theire just confused. and curiousdanny and samantha phantom are curious on how is classic galactosemia a disabilitydanny fenton holding onto mckenna and sphia during theire fear of tornado'sdanny fenton-phantom holding onto mckenna and sphia during theire fear of tornado'sdanny phantom holding onto mckenna and sphia during theire fear of tornado'sinfant newborn twin babie's: mckenna and sophia fenton-phantom are born with severe type1 classic galactosemia. and are classic galactosemia carrier's. they were born without any enzyme's to dygest anything milk or dairy. this rare disease had doctor's forcing danny and samantha fenton-phantom to do a carrier testing. wich result's.they are classic galactosemia carrier's. and have the disease.with on top of this they were born without any enzyme's to dygest anything milk or dairy. just like theire infant newborn twin babie's has the rare genetic-metabolic disorder. this is a big worry to mommy and daddy. this disease causes worry. and ptsd to the whole familyit's okay to cry, even comic heroes do. danny fenton said. trying his best comforting sophia and mckennait's okay to cry, even comic heroes do. danny fenton-phantom said. trying his best comforting sophia and mckennait's okay to cry, even comic heroes do. danny phantom said. trying his best comforting sophia and mckennamckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia fenton get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them down. mommy and daddy. including the whole family are really scared seeing them having convulsion'smckenna and sophia fenton was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilitymckenna and sophia fenton-phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia fenton-phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia fenton-phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them down. mommy and daddy. including the whole family are really scared seeing them having convulsion'smckenna and sophia fenton-phantom was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilitymckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressivemckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them downmckenna and sophia phantom get's so scared during a tornado warning. theire daddy (danny fenton-phantom). trie's to sedate them. theire shaken. and hyperventilating. and are very sweaty. but they become unknowingly and uncontrollably. including unintentionally wildly physically aggressive. causing the twin's screaming. throwing them into convulsion's. daddy trie's to restrain and control them. trying to calm them down. mommy and daddy. including the whole family are really scared seeing them having convulsion'smckenna and sophia phantom was born with classic galactosemia. and are carrier's. they were born with any enzyme's to dygest anything milk or dairy. danny and samantha learn's they have it. and carry it. but then they learn they were born without any enzyme's to dygest anything milk. or dairy. just like soph. and kenna were born with this rare genetic-metabolic disabilityphantom twin's. McKenna and Sophia Fenton are half ghost, half human kids. their mom was very ill when she gave birth to them. they have a rare illness named classic galactosemia. their parent's, Danny and Samantha Fenton, take good care of them. they need to become full ghosts by the age of 14, or they will lose theire ghost powers forever. if this happens, they will die and become fully inactive ghostsptsdptsd carrier's
Load
Percy Jackson Vocabulary Chapters 1-6
Sunday
Apr 28, 2024
anticipatingdesperatelydetermineddisintegrateglinthallucinationholographicimpulsiveintimidatelumbermaterializemisinterpretingmournfullyobliteratedprobationprominentlypursuereeksolsticevaporizevividwistful
Load
Yr
Sunday
Apr 28, 2024
AppleBall CatDogEggFrogGoatHatIceJogKeep LaughMomNestOwlParrotQueen RatSatTvUranusVenusWrongYachtZebra
Load
wendy May
Sunday
Apr 28, 2024
armfulcarefulclearlycountlessfondnessgladlyhelplessillnesspaymenttreatment
Load
Wonders 2.1.1b
Trea Mac
Sunday
Apr 28, 2024
chancecrowdfairlanguagepleadproudscurries
Load
sped 4 reading 641709-1085172-fg27
lillie
Sunday
Apr 28, 2024
cryfully-inactivefully-inactive permanent ghostfully-inactive permanent phantomfully-inactive permanent phantom ghostit's okay to cry, even comic heroes doit's okay to cry, even comic heroes do. danny fenton said. trying his best comforting sophia and mckennait's okay to cry, even comic heroes do. danny fenton-phantom said. trying his best comforting sophia and mckennait's okay to cry, even comic heroes do. danny phantom said. trying his best comforting sophia and mckennajennifer fenton don't like spinachmckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddyphantom twin's. McKenna and Sophia Fenton are half ghost, half human kids. Their mom was very ill when she gave birth to them. They have a rare illness named classic galactosemia. Their parents, Danny and Samantha Fenton, take good care of them. They need to become full ghosts by the age of 14, or they will lose their ghost powers forever. If this happens, they will die and become fully inactive ghostsptsdptsd carrier's
Load
sped 4 reading 641708-1085170-tjsk
lillie
Sunday
Apr 28, 2024
cryfully-inactive permanent phantominactivemckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire a set of twin's. theire a set of twin character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom'smckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddyphantom twin's. McKenna and Sophia Fenton are half ghost, half human kids. Their mom was very ill when she gave birth to them. They have a rare illness named classic galactosemia. Their parents, Danny and Samantha Fenton, take good care of them. They need to become full ghosts by the age of 14, or they will lose their ghost powers forever. If this happens, they will die and become fully inactive ghostsptsdptsd carrier's
Load
sped 4/5 ela reading 641707
lillie
Sunday
Apr 28, 2024
cryfully-inactive permanent phantominactiveinactive ghostinactive ghost twin'sinactive twin'smckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire a set of twin's. theire a set of twin character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom'smckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddyphantom twin's. McKenna and Sophia Fenton are half ghost, half human kids. Their mom was very ill when she gave birth to them. They have a rare illness named classic galactosemia. Their parents, Danny and Samantha Fenton, take good care of them. They need to become full ghosts by the age of 14, or they will lose their ghost powers forever. If this happens, they will die and become fully inactive ghostsptsd carrier's
Load
Ea words
Robin Proctor
Sunday
Apr 28, 2024
beatcheapdreamleapleavemeatpeachpleaseseatteateachteamtweakyearyeast
Load
Mr. Carlo
Sunday
Apr 28, 2024
carddowneveryneednevernextoneonlypushrabbitrivertodaytowntreewater
Load
P Thomas
Sunday
Apr 28, 2024
AskewConspiracyDeliberateDerelictDisperseDistractionGingerlyImmaculateImpactIndignantLacerationMarginalMeleeMelodramaticNestleObliviousProdRefuteSaunterSurreal
Load
Week 1 and 2 Vocabulary
P Thomas
Sunday
Apr 28, 2024
AlternativeAuthorityBawlCockyComebackDeclineDilemmaDroneDutifulGirthMandatoryMisdemeanorObligatoryParanoidReflexScowlStereotypicalSubmitToppleTransfix
Load
sped 4 read and paragraph 641702
Sunday
Apr 28, 2024
a set of phantom twin's. McKenna and Sophia Fenton are half ghost-half human kid's. theire mom was very ill when she gave birth to them. they have a rare illness named: classic galactosemia. theire parent's, Danny and Samantha Fenton, take good care of them. they need to become full ghost's by the age of 14. or they will lose theire ghost power's forever. if this happen's, they will die and become fully inactive ghost'sa set of phantom twin's. McKenna and Sophia Fenton. are half ghost-half human kid's. theire mom was very ill when she gave birth to them. they have a rare illness since birth. named: classic galactosemia. theire parent's, Danny and Samantha Fenton, take good care of them. they need to become full ghost's by the age of 14. or they will lose theire ghost power's forever. if this happen's, they will die and become fully inactive ghost'scrydanny and samantha fenton sedating theire youngest children- twin daughter's: mckenna. and sophia. to try to calm them downfully-inactive permanent phantommckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghostmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turnedmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turned. then theire ghost-human status will be full ghost like theire family already ismckenna and sophia fenton has ptsdmckenna and sophia fenton-phantom has ptsdmckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom'smckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddymckenna and sophia phantom has ptsdptsdsped grade4 reading comprhension. online distence-inclement weather day. from 8:30am/to 3:30pm learning day. test one hour| 8:30am/9:45am test two hour| 9:53am/12:53pm. lunch/recess| 12:53pm/1:30pm. test three hour| 1:45pm/2:10pm final hour| 2:40pm/3:30pm
Load
Unit 5 Week 3
Sunday
Apr 28, 2024
addressbalancecinderscomplainconcreteconstructioncraterdestroydetourdistractearlyenvironmentexplainhundredimprovelavameasuremonsterostrichpumpkinreactionrememberresources
Load
P Thomas
Sunday
Apr 28, 2024
AskewConspiracyDeliberateDerelictDisperseDistractionGingerlyImmaculateImpactIndignantLacerationMarginalMeleeMelodramaticNestleObliviousProdRefuteSaunterSurreal
Load
The Courageous Saga of Our Firefighters
Dheeraj Nadamwar
Sunday
Apr 28, 2024
AdversityAmidst the debrisBeacons of hopeCourageousDiminishingEtchedFierceFierce resolveFraughtOnslaught ofRelentlesslySmolderingSootSteaksStuckTownsflokunfazed
Load
Week 13 Spelling Words
Lori Bates
Sunday
Apr 28, 2024
criedcryfamilyfinallyladiesladymysteriesmysteryonlyshoesshystorystudiedstudysurprisesurprisestoys
Load
Vocabulario Revision Sem. 34
Berenice Long
Sunday
Apr 28, 2024
cafeteriacarnavalcontaminaciondemocraciaeleccioneleganteestadiogasolinagobiernohumillarideainocentelegislarleyliteraturamelancoliamonarquiaprobabilidadrepublicatranquilo
Load
Unit 4 Lesson 2
Jody Smith
Sunday
Apr 28, 2024
activistcarnivorouscartoonistcautiouschemistcolonistcyclistferociousfloristfuriousgraciousguitaristjournalistmarvelousmysteriousnumerousoptimistridiculousvenomouszoologist
Load
sped 4th reading 1085134-7jkx-641695
Sunday
Apr 28, 2024
critical tornadocritical tornado emergencycritical tornado warningcritical tornado warning emergencycrydanny and samantha fenton sedating theire youngest children- twin daughter's: mckenna. and sophia. to try to calm them downdanny fentondanny fenton sedating his and samantha's youngest children- twin daughter's: mckenna. sophia. whenever they get so scareddanny fenton-phantomdanny fenton-phantom sedating his and samantha's youngest children- twin daughter's: mckenna. sophia. whenever they get so scareddanny phantomdanny phantom sedating his and samantha's youngest children- twin daughter's: mckenna. sophia. whenever they get so scaredextreme tornadoextreme tornado emergencyextreme tornado warningextreme tornado warning emergencyfully-inactive permanent phantomghosttwin'sghosttwin's. mckenna and sophia fenton. are scared of storm's or tornado'smckenna and sophia fentonmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghostmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turnedmckenna and sophia fenton are hybrid half ghost-half human-half phantom fully-inactive tribrid inactivated ghost. untill or unless they can completely turned. then theire ghost-human status will be full ghost like theire family already ismckenna and sophia fenton scared of tornado'smckenna and sophia fenton scared of tornado's. danny trying to calm them downmckenna and sophia fenton scared of tornado's. danny trying to calm them down. but he can't. only option. sedate themmckenna and sophia fenton scared of tornado's. danny trying to calm them down. but he can't. only option. sedationmckenna and sophia fenton-phantommckenna and sophia fenton-phantom scared of tornado'smckenna and sophia fenton-phantom scared of tornado's. danny trying to calm them downmckenna and sophia fenton-phantom scared of tornado's. danny trying to calm them down. but he can't. only option. sedate themmckenna and sophia fenton-phantom scared of tornado's. danny trying to calm them down. but he can't. only option. sedationmckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom'smckenna and sophia fenton. are half ghost-half human children. theire mother was very sick when she had them. theire just two character's who were born with a rare disease called: classic galactosemia. but. are taken care of by danny and samantha fenton. they have to fully-transition them by atleast 14 year's old. or theire ghost power's will be permanently inactive. then they'd die. becomming fully-ghostzone-inactive phantom's. the "fully-inactive permanent phantom." thing really scare's mommy and daddymckenna and sophia phantommckenna and sophia phantom scared of tornado'smckenna and sophia phantom scared of tornado's. danny trying to calm them downmckenna and sophia phantom scared of tornado's. danny trying to calm them down. but he can't. only option. sedate themmckenna and sophia phantom scared of tornado's. danny trying to calm them down. but he can't. only option. sedationptsdsedatesedatingsedationsedative
Load
Sunday
Apr 28, 2024
BickerBrokerDiscreetIntentNimble PonderProspectQuipRatifyStoic
Load
Sunday
Apr 28, 2024
chainclasygrainplainplayslaystaystrainstraytrain
Load
M2W2
Sunday
Apr 28, 2024
allowedaloudcentdaysdazefeatfeethealheardheelherdhomophoneminerminorpeakpeekscentsentvainvaneveinwaitweightwho'swhose
Load
M2W1
Sunday
Apr 28, 2024
accomplishapproachblackboastbonuscoastcontinentfellowglobehostknownlocatemotionoatmealoddonlineremotescoldshockshownslopesolvestockthroatwrote
Load
M1W3 Revised
Sunday
Apr 28, 2024
brickbrightenbuildchillcrimedecidedelightdistrictditchflightfrightgrindinchliveremindrigidsighskillspinningsplicesurprisetickettonightwindwitness
Load
M1W1
Sunday
Apr 28, 2024
amazeashamedbladebreakcrayondelaydrainexactfactglassgracefulgraspgrayhangjailmagicmaybepastquakeraftremainsalestainstalesteak
Load
M9W3
Sunday
Apr 28, 2024
anklearticlebarrelbattlecoastaleaglefiddlefossilgentlejugglemarvelmetalmodelnicklequarellretitleriddlesignalsimplespecialsquirreltotaltoweltroubleuntangle
Load
Sunday
Apr 28, 2024
mulebookcook cutecutefoot fullhoodhookhugelookpullpushshooksoottookusewood
Load
M9W2
Sunday
Apr 28, 2024
actorarmorbannerbeggarbothercircularcollardoctorenterfavorfeverfingerharborlabormirrormotorpartnerpolarpowershowersugarsweatertempertraitorwhenever
Load
M9W1
Sunday
Apr 28, 2024
FebruaryIndiaJanuarycerealcreatediarygenuineidealiarlionmeteorpatriotperiodpianopoempoetpunctuatequietradiorodeoscienceusualvideoviolinvisual
Load
M8W3
Sunday
Apr 28, 2024
addressalthougharcticathletecompleteexplainfartherhomelesshundredinsteadkingdommiddlemischiefmonsterorchardpilgrimpurchasesamplesandwichsculptorsettlesinglesupplysurpriseturtle
Load
M8W2
Sunday
Apr 28, 2024
achieveagreeapronauthorbracketbucketbushelchickenclothingcurtaindeclaredeclinedegreedisturbformalgathermachineposterracketrathersecrettickettimberwhetherwhiskers
Load
M8W1
Sunday
Apr 28, 2024
aheadbrokencapturecornerdentistdinnerdisguisedividefamousfinalfinishhollowminusminutenarrowpredictrecentrewardrobinsecuresheltersilverstampedestandardvalue
Load
Level 3 i-e
Sunday
Apr 28, 2024
alivechimecrimedrivefirehireinsideprizeshinesmilespinewhile
Load
Year 7, Term 3, Spelling List 2
Sunday
Apr 28, 2024
adviceadvisebreathbreathedefinitelydevicethoughthoughtthrough
Load
Year 7, Term 3, Vocabulary List 1
Sunday
Apr 28, 2024
apologiesat your earliest convenienceconsiderconsiderablecontactdemandfurtherfurthermorehoweverinformmoreoverpositiverequire
Load
Sunday
Apr 28, 2024
AustraliaEgyptbureaucracycampaigncharacterdefinitelykindergartenliaisonnarrativepamphletphenomenalrestaurantsettingsilhouettesouvenir
Load
Term 2, Week 3, 2024 Mrs Auchter's Year 7
Sunday
Apr 28, 2024
accompanyaccumulateadjoiningadjournappreciateappropriatearidattentionattributedesertdessertdisorientateddissatisfiedsand dunessandy
Load
Unit 7: Ants in a Hurry
Joy Shen
Saturday
Apr 27, 2024
drinkhurrylaynibblesipsslowlyswallowwork
Load
Success 1 Lesson 4
Joy Shen
Saturday
Apr 27, 2024
anxiousfledfleelobbypipe upthrow a party
Load
sped 4/5 reading 641674
Saturday
Apr 27, 2024
asparagusblack bean'scabbagedried green bean'seggplant'sfish
Load
Kid Starter Week 2
Cherry
Saturday
Apr 27, 2024
chaircrayondeskelkeraserhappyhenpaperpensad
Load
sped 4/5 reading 641672-1085085-2grp
lillith
Saturday
Apr 27, 2024
confiscate tv privilege's for a month from dj. and lillithconfiscate tv privilege's for awhile from dj. and lilithconfiscate tv privilege's for awhile from dj. and lillith.after sneaking into ghost zonecrydanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny and samantha fenton-phantom. ghost-human. or phantom fourm. feel uncomfortable punishing or disciplining mckenna or sophia. so they don't punish or discipline theire youngest babies. but instead. they just grab them gently by shoulder's. soft-gently kindly warn them "nono. that's wrong." clinge them tight for hug's and kisses. softly-gently tightly hold's them carefully with love's. and mentor them. and guide them with right from wrong. and give afew soft quick-gentle tap's on sholder-neartheire neck. and a talk on right from wrong. and they tell them "yall aren't in trouble. i know yall don't know any better. or yall don't know right or wrong. but. were alway's here to help you. and toteach you." and they give eachother alot of hug's and kissesdanny fenton had to confiscate dj's flipphone from scary sneaking stuntdanny fenton had to confiscate lilith's flipphonedanny fenton is severely disappointed in dj and lilithdanny fenton taking privilege's away from dj. and lilithdanny fenton trying to calm mckenna and sophia down from cryingdanny fenton-phantom trying to calm mckenna and sophia down from cryingdanny having serious talk with dj. and lilith about theire action'sdanny having serious talk with dj. and lilith about theire attitudedanny having serious talk with dj. and lilith about theire behaviordanny having serious talk with dj. and lilith about theire serious stunt they just pulleddanny having serious talk with dj. and lilith about theire situation of sneaking into ghost zonedanny phantom trying to calm mckenna and sophia down from cryingdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherfighting fear with is a hard theme in sophia and mckenna fenton-phantomfighting fear with is a hard theme with sophia and mckenna fenton-phantomfighting fear with is hard for sophia and mckenna fenton-phantomfighting fear with is hard with sophia and mckenna fenton-phantomin a comic as a punishment for his dangerous actions, Danny decided to confiscate TV privileges for a whole month. from dj. and lillymckenna and sophia fenton are very shaken up in fearmckenna and sophia fenton are very shaken up with fearmckenna and sophia fenton cryingmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fear. daddy pull's him away. but then put's gentle hand's to the girl's wrist's. letting them know him. and mommy are here with themmckenna and sophia fenton take's a life-threatening fear during a frightening near death experience scare's them to death when dj. and lilith force's them to sneak into the ghost zone. mommy and daddy trie's calming them downmckenna and sophia fenton-phantom cryingmckenna and sophia phantom cryingparent's severely angry at dj. and lilithsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zoneserious talk with dj. and lilith about theire action'sserious talk with dj. and lilith about theire attitudeserious talk with dj. and lilith about theire behaviorserious talk with dj. and lilith about theire serious stunt they just pulledserious talk with dj. and lilith about theire situation of involving theire twin baby sister's: mckenna. and sophia. into sneaking off into ghost zonethe comic book ended on a cliffhanger when Danny Fenton had to confiscate DJ's flip phone due to some cryptic messages
Load
sped 4 reading 641671-1085080-jhch
lillith
Saturday
Apr 27, 2024
confiscate tv privilege's for a month from dj. and lillithconfiscate tv privilege's for awhile from dj. and lilithconfiscate tv privilege's for awhile from dj. and lillith.after sneaking into ghost zonecrydanny and samantha fenton confiscate dj. and lilith's tv privilege'sdanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonedanny fenton give's afew serious-forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a disciplindanny fenton give's afew serious-forced sharp slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. he hated he had to do this to them. but he couldn't think anything to do. he'd been so severely angry at them for scaring the twin's. he had to punish them of someway in a disciplindanny fenton had to confiscate dj's flipphone from scary sneaking stuntdanny fenton had to confiscate lilith's flipphonedanny fenton is severely disappointed in dj and lilithdanny fenton taking privilege's awayfrom dj. and lilithdanny fenton tell's dj. and lilith "there's serious lesson's. rightnow. you idiot's need to learn. before you can get you'r dang phone's back." this is upsetting to the kid'sdanny fenton tell's dj. and lilith "there's serious lesson's. rightnow. you idiot's need to learn. if you wan't you'r dang phone's back." this is upsetting to the kid'sdanny fenton trying to calm mckenna and sophia down from cryingdanny fenton-phantom trying to calm mckenna and sophia down from cryingdanny having serious talk with dj. and lilith about theire action'sdanny having serious talk with dj. and lilith about theire attitudedanny having serious talk with dj. and lilith about theire behaviordanny having serious talk with dj. and lilith about theire serious stunt they just pulleddanny having serious talk with dj. and lilith about theire situation of sneaking into ghost zonedanny phantom trying to calm mckenna and sophia down from cryingdanny, jr. and lilith fenton sneak's into ghost zone. parent's find's out. trouble ahead. 3 month's grounding. with no phone or electronic's-technology device's. no goin' out anywhere's but to school or ghost training or ghost emergencies. or ghost hunting with daddy. and no texting. if they wanna' talk to friend's it's either they visit at the fenton's house. or see eachother in school. or they write eachotherdj fenton in school gym. in anger of loosing phone privilege's. blowing off afew anger steam's. by playing basketball. luckily. daddy see's him practicing basketball. and offer's to help him. he ask's "do you need help. blow off you'r steam instead of anger or aggression over you'r own action's of scaring the twin's?" suprizingly dj accept's daddy's offer with answer "yes. go ahead." they play about a 3 hour's worth basketball match. and dj's anger is gone. daddy suprisingly give's him his phone back except in one condition with his phone. his wording: "here. but you'r still grounded." dj accept's. "uumm. o-ok? but i'm not mad anymore. i just hate losing privilege's. but thank's." daddy understand's this. they hug eachother. dj is happy tear's his phone privilege's are back. but danny has a word: "one condition. curfew 9:00pm phone up before then. instead of a 10:00pm usual bedtime. tech device's usually up before ten. you'r cerfewed." dj in sad face. accept's. to avoide. anything further. "aww. ok. i'll take. i don't wan't anything worse." daddy thank's him for accepting this conditionfighting fear with is a hard theme in sophia and mckenna fenton-phantomfighting fear with is a hard theme with sophia and mckenna fenton-phantomfighting fear with is hard for sophia and mckenna fenton-phantomfighting fear with is hard with sophia and mckenna fenton-phantomin a comic as a punishment for his dangerous actions, Danny decided to confiscate TV privileges for a whole month. from dj. and lillymckenna and sophia fenton are very shaken up in fearmckenna and sophia fenton are very shaken up with fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fearmckenna and sophia fenton severely scared. screaming. and crying. but are unknowingly and unintentionally slapping dj in fear. daddy pull's him away. but then put's gentle hand's to the girl's wrist's. letting them know him. and mommy are here with themmckenna and sophia fenton take's a life-threatening fear during a frightening near death experience scare's them to death when dj. and lilith force's them to sneak into the ghost zone. mommy and daddy trie's calming them downparent's severely angry at dj. and lilithsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zonesamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did itsamantha fenton give's afew medium forced hard slap's to dj. and lilith. to theire shouldier's for the scary stunt in the twin's. being involved in sneaking into ghost zone. she feel's bad she did this. but danny agree's they deserve it on them for scaring the twin's into this stuntserious consequencesserious talk with dj. and lilith about theire action'sserious talk with dj. and lilith about theire attitudeserious talk with dj. and lilith about theire behaviorserious talk with dj. and lilith about theire serious stunt they just pulledserious talk with dj. and lilith about theire situation of involving theire twin baby sister's: mckenna. and sophia. into sneaking off into ghost zonethe comic book ended on a cliffhanger when Danny Fenton had to confiscate DJ's flip phone due to some cryptic messages
Load
sped 4/5 reading 641670-1085084-gg15
lillith
Saturday
Apr 27, 2024
apple cider vinegar soaked asparagusblistered basil herb grilled violife-mexican style cheesie asparagus soupcajun style cayenne garlic sauce cinnamon-cider cilantro garlic powder sauce asparagusdeep south dish seafood asparaguseuropeean garlic style meatless-steaksauce asparagusfinland style meatless pepperoni pepperchini style garlic-pepper asparagus stewgreen bean's asparagushawaiian hibachi sauce hibuscus asparagusitalian style meatless sausage italian dressing asparagusjamickan style jalapeño asparaguskale spinach-turmeric turnipgreen asparaguslemon-lime garlic sauce vinegar garlic salt violife cheese asparagus stewmeatless chicken asparagus
Load